4.38 Rating by ClearWebStats
funadventureparks.com is 5 years 2 months 6 days old. This website has a #700,480 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 960.00 and has a daily earning of $ 4.00. While no active threats were reported recently by users, funadventureparks.com is SAFE to browse.
Get Custom Widget

Traffic Report of Funadventureparks

Daily Unique Visitors: 687
Daily Pageviews: 1,374

Estimated Valuation

Income Per Day: $ 4.00
Estimated Worth: $ 960.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 700,480
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
59
Siteadvisor Rating
View funadventureparks.com site advisor rating Not Applicable

Where is funadventureparks.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with funadventureparks.com

Hosted Country:

funadventureparks.com hosted country US funadventureparks.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View funadventureparks.com HTML resources

Homepage Links Analysis

Fun Adventure Parks – Best Weekend Spots

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 6
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

funadventureparks.com favicon - jenniferchemsales.com

View funadventureparks.com Pagerank   funadventureparks.com alexa rank Not Applicable   funadventureparks.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

funadventureparks.com favicon - shrivishwakarmasafetytraininginstitute.com

View funadventureparks.com Pagerank   funadventureparks.com alexa rank Not Applicable   funadventureparks.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

funadventureparks.com favicon - theshineenglishacademy.com

View funadventureparks.com Pagerank   funadventureparks.com alexa rank Not Applicable   funadventureparks.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

funadventureparks.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View funadventureparks.com Pagerank   funadventureparks.com alexa rank Not Applicable   funadventureparks.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

funadventureparks.com favicon - 247bestpillpharma.com

View funadventureparks.com Pagerank   funadventureparks.com alexa rank Not Applicable   funadventureparks.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 14 Mar 2020 10:08:48 GMT
Server: Apache/2.4.41 (cPanel) OpenSSL/1.1.1d mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/7.1.27
Link: <http://funadventureparks.com/wp-json/>; rel="https://api.w.org/"
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 5651
Content-Type: text/html; charset=UTF-8

Domain Information for funadventureparks.com

Domain Registrar: Dreamscape Networks International Pte Ltd funadventureparks.com registrar info
Registration Date: 2019-03-09 5 years 2 months 6 days ago
Last Modified: 2020-03-11 4 years 2 months 2 days ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net funadventureparks.com name server information 162.241.148.33 funadventureparks.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net funadventureparks.com name server information 162.241.148.33 funadventureparks.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
funadventureparks.com A 14381 IP:162.241.148.33
funadventureparks.com NS 86400 Target:ns2.bh-ht-17.webhostbox.net
funadventureparks.com NS 86400 Target:ns1.bh-ht-17.webhostbox.net
funadventureparks.com SOA 86400 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:cpanel.webhostbox.net
Serial:2020031300
Refresh:3600
Retry:7200
Expire:1209600
funadventureparks.com MX 14400 Target:funadventureparks.com
funadventureparks.com TXT 14400 TXT:v=spf1 a mx include:webhostbox.net ~all

Similarly Ranked Websites to Funadventureparks

Oracle Apps | SAP Online Training | Kuncham Online It Training

funadventureparks.com favicon - k-onlines.com

KUNCHAM Online IT Training, Hyderabad. Most of the students got placed immediately after the training at K-Onlines, we offer both online and corporate training.

View funadventureparks.com Pagerank   Alexa rank for funadventureparks.com 700,481   website value of funadventureparks.com $ 960.00

Software innovativo per le aziende | EcosAgile

funadventureparks.com favicon - ecosagile.com

EcosAgile è una delle piattaforme software più innovative sul mercato, fornisce vero valore alla vostra organizzazione a superare gli attuali limiti delle soluzioni rigide e preconfigurate, liberando le energie della vostra organizzazione.

View funadventureparks.com Pagerank   Alexa rank for funadventureparks.com 700,481   website value of funadventureparks.com $ 960.00

鎼滈〉娓歌

funadventureparks.com favicon - soyeyou.com

View funadventureparks.com Pagerank   Alexa rank for funadventureparks.com 700,481   website value of funadventureparks.com $ 960.00

Лучший интернет магазин!

funadventureparks.com favicon - royal-gooods.ru

View funadventureparks.com Pagerank   Alexa rank for funadventureparks.com 700,481   website value of funadventureparks.com $ 960.00

Centro Europeo de Barcelona - Centro Cultural

funadventureparks.com favicon - centroeuropeo.es

Actividades y Viajes culturales. Excursiones, Visitas de Arte e Historia, Senderismo y Nordic Walking, Viajes por Europa. Profesores y Guías especializados.

View funadventureparks.com Pagerank   Alexa rank for funadventureparks.com 700,482   website value of funadventureparks.com $ 960.00

Full WHOIS Lookup for funadventureparks.com

Domain Name: FUNADVENTUREPARKS.COM
Registry Domain ID: 2367547648_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.crazydomains.com
Registrar URL: http://www.crazydomains.com.au
Updated Date: 2020-03-11T07:25:58Z
Creation Date: 2019-03-09T07:01:14Z
Registry Expiry Date: 2021-03-09T07:01:14Z
Registrar: Dreamscape Networks International Pte Ltd
Registrar IANA ID: 1291
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +61 894 220 890
Domain Status: ok https://icann.org/epp#ok
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-03-14T10:09:07Z